GNL3 Antibody - N-terminal region : HRP

GNL3 Antibody - N-terminal region : HRP
SKU
AVIARP58826_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3

Key Reference: Ma,H. (2007) Mol. Biol. Cell 18 (7), 2630-2635

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein-like 3

Protein Size: 537

Purification: Affinity Purified
More Information
SKU AVIARP58826_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58826_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26354
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×