GOLGA7 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGA7

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Golgin subfamily A member 7

Protein Size: 137

Purification: Affinity Purified

• SKU: AVIARP56836_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56836_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51125
• Host: Rabbit