GOPC Antibody - C-terminal region : Biotin

GOPC Antibody - C-terminal region : Biotin
SKU
AVIARP58936_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GOPC

Key Reference: N/A

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: QLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein

Protein Size: 462

Purification: Affinity purified
More Information
SKU AVIARP58936_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58936_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57120
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×