GOPC Antibody - N-terminal region : Biotin

GOPC Antibody - N-terminal region : Biotin
SKU
AVIARP56214_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOPC

Key Reference: Wolde,M., (2007) J. Biol. Chem. 282 (11), 8099-8109

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgi-associated PDZ and coiled-coil motif-containing protein

Protein Size: 454

Purification: Affinity Purified
More Information
SKU AVIARP56214_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56214_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57120
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×