GPALPP1 Antibody - middle region : Biotin

GPALPP1 Antibody - middle region : Biotin
SKU
AVIARP57273_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GPAM1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKNKPQERIPFDRDKDLKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GPALPP motifs-containing protein 1

Protein Size: 191

Purification: Affinity Purified
More Information
SKU AVIARP57273_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57273_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55425
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×