GPR83 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: GPR83 is an orphan receptor. GPR83 could be a neuropeptide Y receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GPR83

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable G-protein coupled receptor 83

Protein Size: 423

Purification: Affinity Purified

• SKU: AVIARP59122_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59122_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10888
• Host: Rabbit