GPR83 Antibody - C-terminal region : Biotin

GPR83 Antibody - C-terminal region : Biotin
SKU
AVIARP59122_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GPR83 is an orphan receptor. GPR83 could be a neuropeptide Y receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GPR83

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable G-protein coupled receptor 83

Protein Size: 423

Purification: Affinity Purified
More Information
SKU AVIARP59122_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59122_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10888
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×