GRB2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: AKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Growth factor receptor-bound protein 2

Protein Size: 217

Purification: Affinity Purified

• SKU: AVIARP58474_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58474_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2885
• Host: Rabbit
• Conjugate: Conjugated, HRP