GRN Antibody - middle region : Biotin

GRN Antibody - middle region : Biotin
SKU
AVIARP54642_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GRN

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Granulins

Protein Size: 438

Purification: Affinity purified
More Information
SKU AVIARP54642_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54642_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2896
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×