GSG1L Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: As a component of the inner core of AMPAR complex, GSG1L modifies AMPA receptor (AMPAR) gating.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSG1L

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: NFHTGIWYSCEEELSGLGEKCRSFIDLAPASEKGVLWLSVVSEVLYILLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Germ cell-specific gene 1-like protein

Protein Size: 280

Purification: Affinity Purified

• SKU: AVIARP54557_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54557_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 146395
• Host: Rabbit