GSK3B Antibody - C-terminal region : FITC

GSK3B Antibody - C-terminal region : FITC
SKU
AVIARP54644_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A) and beta, show a high degree of amino acid homology. GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A; MIM 606784) and beta, show a high degree of amino acid homology (Stambolic and Woodgett, 1994 [PubMed 7980435]). GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation (Plyte et al., 1992 [PubMed 1333807]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B

Key Reference: Izumi,N., (2008) J. Biol. Chem. 283 (19), 12981-12991

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycogen synthase kinase-3 beta

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP54644_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54644_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2932
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×