GSPT2 Antibody - N-terminal region : FITC

GSPT2 Antibody - N-terminal region : FITC
SKU
AVIARP55356_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1 (MIM 139259), a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1 (MIM 600285), functions as a polypeptide chain release factor.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-207 BC036077.1 1-207 208-1527 AJ251548.1 12-1331 1528-2497 AK001303.1 1512-2481 2498-2503 AK023155.1 2487-2492

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSPT2

Key Reference: Chauvin,C., (2005) Mol. Cell. Biol. 25 (14), 5801-5811

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic peptide chain release factor GTP-binding subunit ERF3B

Protein Size: 628

Purification: Affinity Purified

Subunit: ERF3B
More Information
SKU AVIARP55356_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55356_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23708
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×