GSTK1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSTK1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutathione S-transferase kappa 1

Protein Size: 226

Purification: Affinity Purified

• SKU: AVIARP55334_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55334_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 373156
• Host: Rabbit