GTF2A1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Transcription initiation factor IIA . and . chains (GTF2A1, TFIIA p35 and p19 subunits, TFIIAL) binding ability of TLP is required for characteristic cytoplasmic localization of TLP. TFIIA may regulate the intracellular molecular state and the function of TLP through its property of binding to TLP.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTF2A1

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription initiation factor IIA subunit 1

Protein Size: 337

Purification: Affinity Purified

Subunit: 1

• SKU: AVIARP58156_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58156_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2957
• Host: Rabbit