GTF2A1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GTF2A1 belongs to the TFIIA subunit 1 family. It is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. This protein induces a conformational change within the TBP/TATA complex that enhances its stability under both in vitro and physiological salt conditions.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2A1

Key Reference: Hieb,A.R., (2007) J. Mol. Biol. 372 (3), 619-632

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription initiation factor IIA subunit 1

Protein Size: 376

Purification: Affinity Purified

Subunit: 1

• SKU: AVIARP58154_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58154_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2957
• Host: Rabbit