Gtf2h5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Gtf2h5 is a component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. It is necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: QFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: General transcription factor IIH subunit 5

Protein Size: 71

Purification: Affinity Purified

Subunit: 5

• SKU: AVIARP55987_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55987_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 66467
• Host: Rabbit