GZMA Antibody - C-terminal region : HRP

GZMA Antibody - C-terminal region : HRP
SKU
AVIARP54794_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GZMA

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Granzyme A

Protein Size: 262

Purification: Affinity Purified
More Information
SKU AVIARP54794_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54794_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3001
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×