H2AFY Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Core histone macro-H2A.1

Protein Size: 369

Purification: Affinity Purified

• SKU: AVIARP58282_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58282_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9555
• Host: Rabbit