H2AFY Antibody - N-terminal region : HRP

H2AFY Antibody - N-terminal region : HRP
SKU
AVIARP58282_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Core histone macro-H2A.1

Protein Size: 369

Purification: Affinity Purified
More Information
SKU AVIARP58282_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58282_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9555
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×