HADH Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HADH

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

Protein Size: 314

Purification: Affinity Purified

• SKU: AVIARP54764_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54764_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3033
• Host: Rabbit