HADH Antibody - middle region : HRP

HADH Antibody - middle region : HRP
SKU
AVIARP54764_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HADH

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

Protein Size: 314

Purification: Affinity Purified
More Information
SKU AVIARP54764_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54764_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3033
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×