HAGH Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HAGH

Key Reference: Xu,Y. (2006) J. Biol. Chem. 281 (36), 26702-26713

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxyacylglutathione hydrolase, mitochondrial

Protein Size: 260

Purification: Affinity Purified

• SKU: AVIARP54514_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54514_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3029
• Host: Rabbit