HEATR4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of the HEATR4 protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEATR4

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HEAT repeat-containing protein 4

Protein Size: 979

Purification: Affinity Purified

• SKU: AVIARP55946_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55946_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 399671
• Host: Rabbit