HECA Antibody - middle region : FITC

HECA Antibody - middle region : FITC
SKU
AVIARP56855_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits termina

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HECA

Key Reference: 0

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Headcase protein homolog

Protein Size: 543

Purification: Affinity Purified
More Information
SKU AVIARP56855_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56855_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51696
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×