HEMGN Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HEMGN

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hemogen

Protein Size: 484

Purification: Affinity Purified

• SKU: AVIARP57794_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57794_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55363
• Host: Rabbit