HEXD Antibody - middle region : Biotin

HEXD Antibody - middle region : Biotin
SKU
AVIARP55666_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HEXDC

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: hexosaminidase D

Protein Size: 585

Purification: Affinity Purified
More Information
SKU AVIARP55666_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55666_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284004
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×