HEXD Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HEXDC

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: hexosaminidase D

Protein Size: 585

Purification: Affinity Purified

• SKU: AVIARP55666_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55666_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284004
• Host: Rabbit