HIPK1 Antibody - middle region : Biotin

HIPK1 Antibody - middle region : Biotin
SKU
AVIARP55866_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIPK1

Key Reference: Li,X., (2005) J. Biol. Chem. 280 (15), 15061-15070

Molecular Weight: 131kDa

Peptide Sequence: Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeodomain-interacting protein kinase 1

Protein Size: 1210

Purification: Affinity Purified
More Information
SKU AVIARP55866_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55866_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 204851
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×