Hmgcl Antibody - C-terminal region : Biotin

Hmgcl Antibody - C-terminal region : Biotin
SKU
AVIARP56278_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Hmgcl is an enzyme of the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hmgcl

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hydroxymethylglutaryl-CoA lyase, mitochondrial

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP56278_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56278_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79238
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×