HNF1A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Key Reference: Eide,S.A., (er) Diabet. Med. (2008) In press

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Hepatocyte nuclear factor 1-alpha

Protein Size: 631

Purification: Affinity Purified

• SKU: AVIARP57904_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57904_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6927
• Host: Rabbit