HOOK2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HOOK2

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRAGSLRAQLEAQRRQVQELQGQRQEEAMKAEKWLFECRNLEEKYESVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Hook homolog 2

Protein Size: 719

Purification: Affinity purified

• SKU: AVIARP54934_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54934_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29911
• Host: Rabbit