HOXB3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HOXB3 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB3 gene is included in a cluster of homeobox B genes located on chromosome 17. The protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXB3

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: SGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQGRIQEAPKLTH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Homeobox protein Hox-B3

Protein Size: 431

Purification: Affinity Purified

• SKU: AVIARP58019_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58019_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3213
• Host: Rabbit