HOXC8 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXC8

Key Reference: Kikugawa,T., (2006) Prostate 66 (10), 1092-1099

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-C8

Protein Size: 242

Purification: Affinity Purified

• SKU: AVIARP57869_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57869_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3224
• Host: Rabbit