HOXD1 Antibody - middle region : FITC

HOXD1 Antibody - middle region : FITC
SKU
AVIARP57870_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXD1

Key Reference: Kosaki,K., (2002) Teratology 65 (2), 50-62

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox protein Hox-D1

Protein Size: 328

Purification: Affinity Purified
More Information
SKU AVIARP57870_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57870_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3231
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×