HSD17B14 Antibody - middle region : FITC

HSD17B14 Antibody - middle region : FITC
SKU
AVIARP56865_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSD17B14

Key Reference: Lukacik,P., (2007) Biochem. J. 402 (3), 419-427

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 17-beta-hydroxysteroid dehydrogenase 14

Protein Size: 270

Purification: Affinity Purified
More Information
SKU AVIARP56865_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56865_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51171
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×