HSPA2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HSPA2 belongs to the heat shock protein 70 family.In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA2

Key Reference: Lee,S.H., (er) Dig. Dis. Sci. (2007) In press

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Heat shock-related 70 kDa protein 2

Protein Size: 639

Purification: Affinity Purified

• SKU: AVIARP55382_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55382_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3306
• Host: Rabbit