Hspbp1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Hspbp1 inhibits chaperone activity by preventing ATP binding.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Hsp70-binding protein 1

Protein Size: 357

Purification: Affinity Purified

• SKU: AVIARP54869_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54869_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 246146
• Host: Rabbit