HSPE1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPE1

Key Reference: Ralph,S., (2007) Cancer Sci. 98 (6), 844-849

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 10 kDa heat shock protein, mitochondrial

Protein Size: 102

Purification: Affinity Purified

• SKU: AVIARP54651_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54651_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3336
• Host: Rabbit