Human Glia Maturation Factor beta Recombinant

Human Glia Maturation Factor beta Recombinant
SKU
BPS90147-B
Packaging Unit
10 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 2-142

Amino Acid Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

Background: GMF-beta is a 17- kDa brain-specific protein that was isolated from bovine brain homogenate as a substance inducing the maturation of normal neurons as well as glial cells, and at first, it was considered to be a neurotrophic factor. The amino acid sequence of GMFB is highly conserved among many species, suggesting that it plays basic roles across many species. The expression of GMF-b is largely limited to the brain, especially the glial cells and some neurons . Schwann cells of the distal segment of the transected nerve express GMF-b, and this induction of GMF-b coincides with the temporal expression of nerve growth factor receptors in the cell. This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.

Description: Recombinant Glia Maturation Factor is a disulfide-linked monomer protein consisting of 142 amino acid residues, and migrates as an approximately 15 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human GMF-beta mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered 20 mM phosphate buffer, 130 mM NaCl solution, pH 7.5.

Genbank: P60983

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P60983

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Circ. Res., Aug 2006, 99: 424 - 433.
2. J. Biol. Chem., Aug 2003, 278: 33519 - 33527.
3. Int. Immunol., May 2003, 15: 557 - 564.
More Information
SKU BPS90147-B
Manufacturer BPS Bioscience
Manufacturer SKU 90147-B
Package Unit 10 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×