Human HCC-1(CCL14) Recombinant

Human HCC-1(CCL14) Recombinant
SKU
BPS90152-A
Packaging Unit
2 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Background: Hemofiltrate C-C chemokine (HCC)-1 is a recently described monocyte chemoattractant. CCL14 (also known as HCC-1) belongs to the CC chemokine family. Its mature propeptide is a low- affinity agonist of CCR1 that is converted to a high- affinity agonist of CCR1 and CCR5 on proteolytic processing by serine proteases. Determination of the amino acid sequence of HCC-1 revealed four cysteine residues in positions characteristic of the C-C chemokine family, and comparison with the sequences of other chemokines revealed that HCC-1 was most homologous to MIP-1a. However, several functional properties of HCC-1 were atypical of chemokines. Unlike other chemokines, HCC-1 was expressed constitutively in a number of tissues and was present at high concentrations in normal human plasma. In addition, HCC-1 was reported not to be chemotactic for leukocytes.

Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/ml.

Description: Recombinant HCC-1 is a disulfide-linked monomeric protein consisting of 73 amino acid residues and migrates as an approximately 9 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human HCC-1 (CCL14) mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered solution of 40 mM NaCl, 10 mM phosphate buffer, pH 7.0.

Genbank: Q16627

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: Q16627

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Leukoc. Biol., Sep 2001, 70: 357.
2. J. Exp. Med., Aug 1998, 188: 603 - 608.
More Information
SKU BPS90152-A
Manufacturer BPS Bioscience
Manufacturer SKU 90152-A
Green Labware No
Package Unit 2 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×