Human HCC-2(CCL15) Recombinant

Human HCC-2(CCL15) Recombinant
SKU
BPS90153-B
Packaging Unit
25 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 22-113

Amino Acid Sequence: QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Background: CCL15 is a human chemokine which acts predominantly on chemokine receptor CCR1 and to a lesser degree on CCR3. It is a potent chemoattractant for monocytes and lymphocytes in vitro and, after immunoprecipitation, CCL15 induces recruitment neutrophils, monocytes, and lymphocytes into mouse peritoneum. CCL15 is constitutively expressed in the gut and in the liver and was identified to circulate in human plasma. The N-terminus of CCL15 was found to be important to exert its full biological activity. HCC-2 shares significant sequence homology with CKb8 and the murine chemokines C10, CCF18/MRP-2, and macrophage inflammatory protein 1g (MIP-1g), which all contain six instead of four conserved cysteines.

Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/ml.

Description: Recombinant HCC-2 is a disulfide-linked monomeric protein consisting of 92 amino acid residues and migrates as an approximately 10 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human HCC-2 (CCL15) mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered solution in 100 mM NaCl, 20 mM phosphate buffer, pH 7.5.

Genbank: Q16663

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: Q16663

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: J. Leukoc. Biol., Sep 2001, 70: 357.
More Information
SKU BPS90153-B
Manufacturer BPS Bioscience
Manufacturer SKU 90153-B
Package Unit 25 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×