Human Interleukin-1 receptor antagonist Recombinant

Human Interleukin-1 receptor antagonist Recombinant
SKU
BPS90170-A
Packaging Unit
20 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 26-177

Amino Acid Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Background: IL1ra is found in the conditioned medium of a variety of cells and is produced by macrophages, monocytes,neutrophils. The soluble form of IL1ra has been shown to be produced by hepatocytes, and to be regulated by pro- inflammatory cytokines.

Biological Activity: The ED50 as determined by the ability to inhibit the IL-1α mediated cell proliferation in a murine helper T cell line in the presence of 50 pg/mL of IL-1α, is typically 20 - 60 ng/mL.

Description: Recombinant IL-1RA is a disulfide-linked monomer protein consisting of 153 amino acid residues, and migrates as an approximately 17 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human interleukin-1 receptor antagonist mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from 0.2 µm filtered PBS, pH 7.4.

Genbank: P18510

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P18510

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Diabetes Care, Sep 2009, 32: 1663 - 1668.
2. N. Engl. J. Med., Jun 2009, 360: 2426 - 2437.
3. Endocrinology, Jun 2009, 150: 2660 - 2667.
More Information
SKU BPS90170-A
Manufacturer BPS Bioscience
Manufacturer SKU 90170-A
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×