Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 26-177
Amino Acid Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Background: IL-7 is secreted constitutively into the conditioned medium of adherent bone marrow stromal cells and thymic cells. Mouse and human keratinocytes have been shown also to express and secrete IL-7. Human (152 amino acids) and murine IL-7 (129 amino acids) show 60% sequence homology at the protein level. The human IL-7 receptor, designated CD127, is an integral strongly glycosylated membrane protein of 76 kDa expressed on activated T-cells. IL-7 receptors are expressed on pre-B-cells and their progenitors and bone marrow macrophages, but they are not expressed on mature B-cells. Functional IL-7 receptors are also found on the cell surface of multiphenotypic, biphenotypic, and immature lymphoid progenitors of B-cells with the gene arrangement of the heavy immunoglobulin chain such as those observed in the germ line.
Biological Activity: The ED50 determined by dose-dependent stimulation of the proliferation of murine 2E8 cells is ≤ 0.5 ng/ml, corresponding to a specific activity of≥ 2 x 10^6 units/mg.
Description: Recombinant human IL-7 is a disulfide-linked monomeric protein consisting of 153 amino acid residues, and migrates as an approximately 17 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Interleukin-7 mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 4.5
Genbank: P13232
Purity: ≥97% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P13232
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Exp. Med., Sep 2009, 206: 2111 - 2119.
2. J. Immunol., Sep 2009, 183: 3130 - 3138.
3. Blood, Aug 2009, 114: 1768 - 1775.
English
Deutsch
