Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 22-98
Amino Acid Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Background: IP10 shows homology to PF4 (platelet factor-4) and belongs to the family of chemotactic cytokines known as Chemokines. The receptor for IP-10 is CXCR3. IP-10 has been shown to bind to the virus-encoded viroceptor M3. The expression of IP-10 from a variety of cells, including monocytes, endothelial cells, keratinocytes, and fibroblasts, is induced by IFN-gamma and TNF-alpha. Human neutrophils produce IP-10 in response to IFN- gamma in combination with either TNF-alpha or bacterial lipopolysaccharides. IP-10 probably also plays a role in regulation of the growth of immature hematopoietic progenitor cells. It has been shown to suppress in vitro colony formation of highly enriched cells expressing the cell surface marker CD34 in the presence of SCF, GM-CSF, or SCF and EPO, but not in their absence with the exception of SCF.
Native human IP-10/CXCL10, generated by the proteolytic removal of the signal peptide and propeptide, the molecule has a calculated molecular mass of approximately 9 kDa.
Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
Description: Recombinant human IP-10 (also known as CXCL10) is a disulfide-linked homodimeric protein consisting of 78 amino acid residues, and migrates as an approximately 9 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human IP-10 mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.0
Genbank: P02778
Purity: ≥97% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P02778
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Invest. Ophthalmol. Vis. Sci., Apr 2008, 49: 3721.
2. J. Biol. Chem., Jan 2001, 276: 2986 - 2991.
English
Deutsch
