Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 22-94
Amino Acid Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Background: The CXC chemokine ligand 11 (CXCL11) or IFN-inducible T-cell-chemoattractant (I-TAC) belongs to the CXC chemokine family characterized by the presence of 1 amino acid in between the 2 NH2-terminal cysteines. CXCL11 is produced by a variety of cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). Simultaneous stimulation of fibroblasts or endothelial cells with IFN-gamma and interleukin-1b or the TLR3 ligand double-stranded RNA resulted in a synergistic increase of CXCL11 production. CXCL11 attracts activated T-helper 1 (Th1) lymphocytes and natural killer (NK) cells. Like CXCL9 and CXCL10, CXCL11 signals through CXC chemokine receptor 3 (CXCR3).
Biological Activity: Determined by its ability to chemoattract human T cells using a concentration range of 2.0-10.0 ng/ml.
Description: Recombinant human CXCL11 (ITAC) is a disulfide-linked monomeric protein consisting of 74 amino acid residues and migrates as an approximately 8 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human ITAC (CXCL11) mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 100 mM NaCl, pH 7.5.
Genbank: O14625
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: O14625
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Biol. Chem., Jul 2008, 283: 19389 - 19399.
2. Blood, Oct 2008, 112: 2648 - 2656.
English
Deutsch
