Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: SIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Background: Monocyte chemotactic protein MCP-2 is a C-C chemokine.It shares over 60% amino acid identity with MCP-1 and MCP-3 and has about 30% identity with other C-C chemokines MIP-1alpha, RANTES, and MIP-1beta. MCP-2 is chemotactic for and activates a wide variety of inflammatory cells, and its spectrum of action on leukocytes is similar to that of MCP-3, including monocytes, T lymphocytes, NK cells, basophils, mast cells, and eosinophils, but differs from MCP-1, which is not active on eosinophils. MCP-2 has been proposed to interact with multiple C-C chemokine receptors, including those used by MCP- 1 and MCP-3. However, since leukocytes express a multiplicity of chemokine receptors with promiscuous binding and functional properties, it is difficult to identify the receptors used by a given ligand on these cells.
Biological Activity: The ED50 was determined by the dose-dependent chemo-attraction of THP1 leukemic cells and was found to be ≤ 50 ng/ml, corresponding to a specific activity of >5x 104 units/mg.
Description: Recombinant MCP-2 is a disulfide-linked monomeric protein consisting of 77 amino acid residues and migrates as an approximately 9 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human MCP-2 (CCL8) mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 100 mM NaCl, pH 7.5.
Genbank: P80075
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P80075
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Immunol., Jan 2009, 182: 522 - 529.
2. Eur. Respir. J., Dec 2008, 32: 1607 - 1615.
3. Journal of Renin-Angiotensin-Aldosterone System, Mar 2007, 8: 45 - 50.
English
Deutsch
