Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Background: Monocyte Chemoattractant Proteins 4 (MCP-4/CCL13) is member of a distinct, structurally-related subclass of CC chemokines. MCP-4/CCL13 is a major chemoattractants for eosinophils, basophils monocytes and T-lymphocytes. The MCP protein family bind to specific G-protein-coupled receptors, initiating a signal cascade within the cell. Expression of MCP-4/CCL13 mRNA and protein is greater in the sputum, epithelium, submucosal inflammatory cells and bronchoalveolar lavage fluid of asthmatics than in healthy individuals. Involvement of MCPs has also been demonstrated in renal inflammation and atopic dermatitis and the expression of this protein is also correlated with enhanced inflammatory immune responses during immunotherapy.
Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 20.0-40.0 ng/ml.
Description: Recombinant MCP-4 is a disulfide-linked monomeric protein consisting of 76 amino acid residues and migrates as an approximately 9 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding human MCP-4 (CCL13) mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 100 mM NaCl, pH 7.5.
Genbank: Q99616
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: Q99616
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Rheumatology, Apr 2006, 45: 421 - 424.
2. Am J Physiol Lung Cell Mol Physiol, Nov 2001, 281: 1288.
3. Am. J. Respir. Crit. Care Med., Aug 2000, 162: 723 - 732.