Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Background: Macrophage inflammatory protein (MIP)-3/CCL20, also known as liver and activation-regulated chemokine (LARC) or Exodus, is a member of the CC chemokine subfamily initially noted to be expressed in human liver, lung, appendix, and tonsillar crypts. MIP-3 is selectively chemotactic for CD34+ bone marrow cell-derived immature DCs and CD45RO+ memory T cells that express the cognate receptor CCR6. MIP-3 produced at sites of inflammation may chemoattract CCR6-expressing immature DCs to the subepithelial region of mucosal surfaces.
Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/ml.
Description: Recombinant MIP-3(CCL-23) is a disulfide-linked monomeric protein consisting of 100 amino acid residues and migrates as an approximately 11 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human MIP-3 mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 100 mM NaCl, pH 7.5.
Genbank: P78556
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P78556
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J Rheumatol, Nov 2009, 36: 2397 - 2402.
2. Arterioscler Thromb Vasc Biol, Oct 2009, 29: 1608 - 1614.
3. Rheumatology, Jul 2009, 48: 741 - 747.
English
Deutsch
