Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 177-237
Amino Acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEF
Background: Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF-like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells.
Biological Activity: The ED50 was determined by the dose-dependent proliferation of human MCF-7 cells was found to be <0.3ng/ml, corresponding to a specific activity of 2x 10^6 Units/mg.
Description: Recombinant human Neuregulin-1 beta EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-1 beta EGF domain was expressed in CHO cells
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 10 mM phosphate buffer, pH 7.0, containing 2% mannitol, 0.5% HSA.
Genbank: Q02297
Host Cell Line: CHO
Purity: ≥96% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: Q02297
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Circulation, Jul 2009, 120: 310 - 317.
2. J. Neurosci., Jun 2009, 29: 7667 - 7678.
3. Invest. Ophthalmol. Vis. Sci., Apr 2009, 50: 2075.
English
Deutsch
