IARS Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IARS

Molecular Weight: 144kDa

Peptide Sequence: Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Isoleucine--tRNA ligase, cytoplasmic

Protein Size: 1262

Purification: Affinity Purified

• SKU: AVIARP54953_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54953_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3376
• Host: Rabbit