IER5 Antibody - N-terminal region : HRP

IER5 Antibody - N-terminal region : HRP
SKU
AVIARP56939_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IER5

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Immediate early response gene 5 protein

Protein Size: 327

Purification: Affinity Purified
More Information
SKU AVIARP56939_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56939_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51278
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×